PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.2G285900.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 255aa    MW: 28324.5 Da    PI: 10.096
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.2G285900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH36.77.4e-1268118355
                         HHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
                 HLH   3 rahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                         ++h e+Er+RR+++ +  + Lr+llP  +   ++K s ++   +Av+YIk+Lq
  Prupe.2G285900.3.p  68 MMHRENERQRRQEMGTLHASLRSLLPLEF--IKGKRSISDHMNEAVNYIKHLQ 118
                         68*************************65..*********************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000837.11E-963122No hitNo description
SuperFamilySSF474593.93E-1264134IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PROSITE profilePS5088812.9765117IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.4E-968118IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.2E-869133IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003530.00271123IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MMFPLHQGKK LVFQTSSNPP QKHTISEDRI LGHAISTGKS RRRKLVAAFN YDMIDQNSND  60
HNKKKKMMMH RENERQRRQE MGTLHASLRS LLPLEFIKGK RSISDHMNEA VNYIKHLQSR  120
IKRLDAKRAE LKKCSNIIST TGTDHGATPG SSDGRSPSCL TVHPCCGGVQ IVISSRGFRS  180
SKDGLSLSFS ISRVLEVLLE QGLAVVSCVS SKGNDRLLHT IQCEVNDLES IDLSGLEQKL  240
AELVSPFSSR CISE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234327.10.0PREDICTED: transcription factor bHLH36-like isoform X2
TrEMBLM5X2S21e-133M5X2S2_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s14080.14e-68(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25410.14e-47bHLH family protein